« Zurück
Home /
Recombinant Mouse Proprotein convertase subtilisin/kexin type 5(Pcsk5)

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5(Pcsk5)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP017644MO-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	Q04592
Gene Names	Pcsk5
Organism	Mus musculus (Mouse)
AA Sequence	DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSD MNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQN YDALASCDVNGNDLDPMPRYDASNENKHGTRCAGE VAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVE AKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTR QAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCD GYTNSIYTISISSTAESGKKPWYLEECSSTLATTY SSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAG IIALALEANPFLTWRDVQHVIVRTSRAGHLNANDW KTNAAGFKVSHLYGFGLMDAE
Expression Region	117-452aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	52.7 kDa
Alternative Name(s)	Proprotein convertase 5 ; PC5Proprotein convertase 6 ; PC6Subtilisin-like proprotein convertase 6 ; SPC6Subtilisin/kexin-like protease PC5
Relevance	Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors .
Reference	Identification of an isoform with an extremely large Cys-rich region of PC6, a Kex2-like processing endoprotease.Nakagawa T., Murakami K., Nakayama K.FEBS Lett. 327:165-171(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive and regulated secretory pathways. Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors.
Subcellular Location	Isoform PC5A: Secreted, Note=Secreted through the regulated secretory pathway, SUBCELLULAR LOCATION: Isoform PC5B: Endomembrane system, Single-pass type I membrane protein
Protein Families	Peptidase S8 family
Tissue Specificity	PC5A is expressed in most tissues but is most abundant in the intestine and adrenals. PC5B is expressed in the intestine, adrenals and lung but not in the brain.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP017644MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen