« Zurück
Home /
Recombinant Human PDZ and LIM domain protein 1(PDLIM1)

Recombinant Human PDZ and LIM domain protein 1(PDLIM1)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP017731HU-500
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	O00151
Gene Names	PDLIM1
Organism	Homo sapiens (Human)
AA Sequence	TTQQIDLQGPGPWGFRLVGGKDFEQPLAISRVTPG SKAALANLCIGDVITAIDGENTSNMTHLEAQNRIK GCTDNLTLTVARSEHKVWSPLVTEEGKRHPYKMNL ASEPQEVLHIGSAHNRSAMPFTASPASSTTARVIT NQYNNPAGLYSSENISNFNNALESKTAASGVEANS RPLDHAQPPSSLVIDKESEVYKMLQEKQELNEPPK QSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTK VAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHP ECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVT PPEGYEVVTVFPK
Expression Region	1-329aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	62.9 kDa
Alternative Name(s)	C-terminal LIM domain protein 1 Elfin LIM domain protein CLP-36
Relevance	Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton.
Reference	"Characterization of the human 36-KDA carboxyl terminal LIM domain protein (hCLIM1)." Kotaka M., Ngai S.M., Garcia-Barcelo M., Tsui S.K.W., Fung K.P., Lee C.Y., Waye M.M.Y. J. Cell. Biochem. 72:279-285(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton
Subcellular Location	Cytoplasm, Cytoplasm, cytoskeleton, Cytoplasm, myofibril, sarcomere, Z line
Tissue Specificity	Strongly expressed in the heart and skeletal muscle, moderately expressed in the spleen, small intestine, colon, placenta, and lung. A lower level expression is seen in liver, thymus, kidney, prostate and pancreas and is not found in the brain, testis, ovary, and peripheral blood leukocytes.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen