« Zurück
Startseite /
Recombinant Human Paraneoplastic antigen Ma2(PNMA2),partial

Recombinant Human Paraneoplastic antigen Ma2(PNMA2),partial

ArtNr	CSB-EP018267HUa2-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	ALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQ EVLQETLKSLGRYRLLGKIFRKQENANAVLLELLE DTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERL NLFLEKEGQTVSGMFRALGQEGVSPATVPCISPEL LAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAP EEESFEVWLEQATEIVKEWPVTEAEKKRWLAESLR GPALDLMHIVQADNPSISVEECLEAFKQVFGSLES RRT
Protein Familie	PNMA family
Citations	"A serologic marker of paraneoplastic limbic and brain-stem encephalitis in patients with testicular cancer." Voltz R., Gultekin S.H., Rosenfeld M.R., Gerstner E., Eichen J., Posner J.B., Dalmau J. N. Engl. J. Med. 340:1788-1795(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	40KDA neuronal protein; Onconeuronal antigen Ma2; Paraneoplastic neuronal antigen MM2
Lieferbar
Manufacturer - Targets	PNMA2
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	57.1 kDa
General Research Areas	Tags & Cell Markers
Relevance	Antibodies against PNMA2 are present in sera from patients suffering of paraneoplastic neurological disorders.
Expression Region	2-361aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Nucleus, nucleolus
Tissue Specificity	Brain-specific. In some cancer patients, specifically expressed by testicular tumor cells.
Biologically active	Not Test
Protein length	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP018267HUa2-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern