Recombinant Human Serine/threonine-protein phosphatase PP1-beta catalytic subunit(PPP1CB)

Signal Transduction

PPP1CB

ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRG LCIKSREIFLSQPILLELEAPLKICGDIHGQYTDL LRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLL LAYKIKYPENFFLLRGNHECASINRIYGFYDECKR RFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLS PDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKD VQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRA HQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVT PPRTANPPKKR

Full Length of Mature Protein

N-terminal 6xHis-tagged

Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208).

Greater than 90% as determined by SDS-PAGE.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.

Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. In balance with CSNK1D and CSNK1E, determines the circadian period length, through the regulation of the speed and rhythmicity of PER1 and PER2 phosphorylation. May dephosphorylate CSNK1D and CSNK1E. Dephosphorylates the 'Ser-418' residue of FOXP3 in regulatory T-cells (Treg) from patients with rheumatoid arthritis, thereby inactivating FOXP3 and rendering Treg cells functionally defective

Cytoplasm, Nucleus, Nucleus, nucleoplasm, Nucleus, nucleolus

cAMPsignalingpathway