« Zurück
Home /
Recombinant Human Receptor-type tyrosine-protein phosphatase C(PTPRC),partial

Recombinant Human Receptor-type tyrosine-protein phosphatase C(PTPRC),partial

Hersteller	Cusabio
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Progenitor Markers
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP019049HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Immunology
Target / Protein	PTPRC
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P08575
AA Sequence	QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPA STFERENDFSETTTSLSPDNTSTQVSPDSLDNASA FNTTGVSSVQTPHLPTHADSQTPSAGTDTQTFSGS AANAKLNPTPGSNAISDVPGERSTASTFPTDPVSP LTTTLSLAHHSSAALPARTSNTTITANTSDAYLNA SETTTLSPSGSAVISTTTIATTPSKPTCDEKYANI TVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEV HNLTECKNASVSISHNSCTAPDKTLILDVPPGVEK FQLHDCTQVEKADTTICLKWKNIETFTCDTQNITY RFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNN HKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVI TWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYD LQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTT KSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPH ERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDY TFKAYFHNGDYPGEPFILHHSTSYNSK
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	24-575aa
Protein length	Extracellular Domain
MW	76.8 kDa
Alternative Name(s)	Leukocyte common antigen
Relevance	Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity
References	"Structural variants of human T200 glycoprotein (leukocyte-common antigen)." Ralph S.J., Thomas M.L., Morton C.C., Trowbridge I.S. EMBO J. 6:1251-1257(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity (By similarity).
Involvement in disease	Severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)B(+)NK(+) SCID); Multiple sclerosis (MS)
Subcellular Location	Membrane, Single-pass type I membrane protein, Membrane raft
Protein Families	Protein-tyrosine phosphatase family, Receptor class 1/6 subfamily
Paythway	FcgammaR-mediatedphagocytosis
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen