Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
E.coli |
ArtNr |
CSB-EP019276HU-10 |
Konjugat/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
P78406 |
Gene Names |
RAE1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVT SSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWE VQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTAS CDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPN YSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYC ADVIYPMAVVATAERGLIVYQLENQPSEFRRIESP LKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYI NPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIA FHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLD QPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKK NYIFLRNAAEELKPRNKK |
Expression Region |
1-368aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
68 kDa |
Alternative Name(s) |
Rae1 protein homolog mRNA-associated protein mrnp 41 |
Relevance |
Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. |
Reference |
"The human RAE1 gene is a functional homologue of Schizosaccharomyces pombe rae1 gene involved in nuclear export of poly(A)+ RNA." Bharathi A., Ghosh A., Whalen W.A., Yoon J.H., Pu R., Dasso M., Dhar R. Gene 198:251-258(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Plays a role in mitotic bipolar spindle formation |
Subcellular Location |
Cytoplasm, Nucleus, Cytoplasm, cytoskeleton, spindle pole |
Protein Families |
WD repeat rae1 family |
Tag Information |
N-terminal GST-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.