« Zurück
Home /
Recombinant Human Rhomboid-related protein 2(RHBDL2),partial

Recombinant Human Rhomboid-related protein 2(RHBDL2),partial

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP019672HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Others
Target / Protein	RHBDL2
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	Q9NX52
AA Sequence	MNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVH RIVSKWMLPEKSRGTYLERANCFPPPVFIISISLA ELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEK REEAWRFISYMLVHAG
Tag Info	N-terminal 6xHis-tagged
Expression Region	12-132aa
Protein length	Partial
MW	18.2 kDa
Alternative Name(s)	Rhomboid-like protein 2
Relevance	Involved in regulated intrambrane proteolysis and the subsequent release of functional polypeptides from their mbrane anchors. Known substrate: EFNB3.
References	The processing of human rhomboid intramembrane serine protease RHBDL2 is required for its proteolytic activity.Lei X., Li Y.M.J. Mol. Biol. 394:815-825(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Known substrate
Subcellular Location	Rhomboid-related protein 2, C-terminal fragment: Cell membrane, Multi-pass membrane protein
Protein Families	Peptidase S54 family
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP019672HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen