Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial

Neuroscience

ROR1

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPM NNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVV QEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVAT NGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGF CQPYRGIACARFIGNRTVYMESLHMQGEIENQITA AFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETS SVPKPRDLCRDECEILENVLCQTEYIFARSNPMIL MRLKLPNCEDLPQPESPEAANCIRIGIPMADPINK NHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHT HTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDE NFKSDLCDIPAC

Extracellular Domain

N-terminal 6xHis-tagged

Neurotrophic tyrosine kinase, receptor-related 1

Patterns of somatic mutation in human cancer genomes.Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.Nature 446:153-158(2007)

Liquid or Lyophilized powder

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.

Deafness, autosomal recessive, 108 (DFNB108)

Protein kinase superfamily, Tyr protein kinase family, ROR subfamily

N-terminal 6xHis-tagged