« Zurück
Home /
Recombinant Mouse 60S acidic ribosomal protein P0(Rplp0)

Recombinant Mouse 60S acidic ribosomal protein P0(Rplp0)

Hersteller	Cusabio
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP020336MO-500
Konjugat/Tag	Myc
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research areas	Epigenetics and Nuclear Signaling
Target / Protein	Rplp0
Biologically active	Not Test
Expression system	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	P14869
AA Sequence	MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNV GSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLE NNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLAN KVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA LGITTKISRGTIEILSDVQLIKTGDKVGASEATLL NMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQA LHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGY KRVLALSVETEYTFPLTEKVKAFLADPSAFAAAAP AAAATTAAPAAAAAPAKAEAKEESEESDEDMGFGL FD
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region	1-317aa
Protein length	Full Length
MW	54.2 kDa
Alternative Name(s)	60S ribosomal protein L10E
Relevance	Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
References	"The mouse homologue of the human acidic ribosomal phosphoprotein PO: a highly conserved polypeptide that is under translational control." Krowczynska A.M., Coutts M., Makrides S., Brawerman G.Nucleic Acids Res. 17:6408-6408(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
Subcellular Location	Nucleus, Cytoplasm
Protein Families	Universal ribosomal protein uL10 family
Tag Information	N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP020336MO-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen