« Back
Home /
Recombinant Mouse 60S acidic ribosomal protein P0(Rplp0)

Recombinant Mouse 60S acidic ribosomal protein P0(Rplp0)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP020336MO-500
Conjugate/Tag	Myc
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Epigenetics and Nuclear Signaling
Target / Protein	Rplp0
Biologically active	Not Test
Expression system	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	P14869
AA Sequence	MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNV GSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLE NNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLAN KVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA LGITTKISRGTIEILSDVQLIKTGDKVGASEATLL NMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQA LHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGY KRVLALSVETEYTFPLTEKVKAFLADPSAFAAAAP AAAATTAAPAAAAAPAKAEAKEESEESDEDMGFGL FD
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region	1-317aa
Protein length	Full Length
MW	54.2 kDa
Alternative Name(s)	60S ribosomal protein L10E
Relevance	Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
References	"The mouse homologue of the human acidic ribosomal phosphoprotein PO: a highly conserved polypeptide that is under translational control." Krowczynska A.M., Coutts M., Makrides S., Brawerman G.Nucleic Acids Res. 17:6408-6408(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
Subcellular Location	Nucleus, Cytoplasm
Protein Families	Universal ribosomal protein uL10 family
Tag Information	N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP020336MO-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time