« Zurück
Home /
Recombinant Human Ras-related protein R-Ras2(RRAS2)

Recombinant Human Ras-related protein R-Ras2(RRAS2)

Hersteller	Cusabio
Kategorie	Neuroscience Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP020514HU-50
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Signal Transduction
Uniprot ID	P62070
Gene Names	RRAS2
Organism	Homo sapiens (Human)
AA Sequence	AAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQ SYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAG QEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYK FQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEE GQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIR KFQEQECPPSPEPTRKEKDKKGCHC
Expression Region	1-204aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	49.9 kDa
Alternative Name(s)	Ras-like protein TC21 Teratocarcinoma oncogene
Relevance	It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
Reference	"Characterization of four novel ras-like genes expressed in a human teratocarcinoma cell line." Drivas G.T., Shih A., Coutavas E., Rush M.G., D'Eustachio P. Mol. Cell. Biol. 10:1793-1798(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
Involvement in disease	Ovarian cancer (OC)
Subcellular Location	Cell membrane, Lipid-anchor, Cytoplasmic side
Protein Families	Small GTPase superfamily, Ras family
Tissue Specificity	Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas.
Paythway	cAMPsignalingpathway
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP020514HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen