« Zurück
Home /
Recombinant Human Runt-related transcription factor 3(RUNX3)

Recombinant Human Runt-related transcription factor 3(RUNX3)

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP020595HU-1
Konjugat/Tag	Myc
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q13761
Gene Names	RUNX3
Organism	Homo sapiens (Human)
AA Sequence	MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGA LSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTD SPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGT VVTVMAGNDENYSAELRNASAVMKNQVARFNDLRF VGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVD GPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTP STPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDP RQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPY SATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGA PQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSS SGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQS DGVEADGSHSNSPTALSTPGRMDEAVWRPY
Expression Region	1-415aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	49.4 kDa
Alternative Name(s)	Acute myeloid leukemia 2 protein Core-binding factor subunit alpha-3 Short name:CBF-alpha-3
Relevance	CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, lck, IL-3 and GM-CSF promoters. In association with ZFHX3, upregulates CDKN1A promoter activity following TGF-beta stimulation (PubMed:20599712).
Reference	AML1, AML2, and AML3, the human members of the runt domain gene-family: cDNA structure, expression, and chromosomal localization.Levanon D., Negreanu V., Bernstein Y., Bar-Am I., Avivi L., Groner Y.Genomics 23:425-432(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, lck, IL-3 and GM-CSF promoters. In association with ZFHX3, upregulates CDKN1A promoter activity following TGF-beta stimulation
Subcellular Location	Nucleus, Cytoplasm
Tissue Specificity	Expressed in gastric cancer tissues (at protein level).
Paythway	Th1andTh2celldifferentiation
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen