« Zurück
Home /
Recombinant Human Selenide, water dikinase 1(SEPHS1)

Recombinant Human Selenide, water dikinase 1(SEPHS1)

Hersteller	Cusabio
Kategorie	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP021015HU-10
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cell Biology
Uniprot ID	P49903
Gene Names	SEPHS1
Organism	Homo sapiens (Human)
AA Sequence	STRESFNPESYELDKSFRLTRFTELKGTGCKVPQD VLQKLLESLQENHFQEDEQFLGAVMPRLGIGMDTC VIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACAN VLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVM PLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVA TTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAV HQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMAR LNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQ QRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGT CPETSGGLLICLPREQAARFCAEIKSPKYGEGHQA WIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNP TPGATS
Expression Region	1-392
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	69.8 kDa
Alternative Name(s)	Selenium donor protein 1 Selenophosphate synthase 1
Relevance	Synthesizes selenophosphate from selenide and ATP.
Reference	"Human selenophosphate synthetase 1 has five splice variants with unique interactions, subcellular localizations and expression patterns." Kim J.Y., Lee K.H., Shim M.S., Shin H., Xu X.M., Carlson B.A., Hatfield D.L., Lee B.J. Biochem. Biophys. Res. Commun. 397:53-58(2010)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Synthesizes selenophosphate from selenide and ATP.
Subcellular Location	Isoform 1: Cell membrane, Nucleus membrane, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm
Protein Families	Selenophosphate synthase 1 family, Class II subfamily
Tissue Specificity	Isoform 1 and isoform 2 are gradually expressed during the cell cycle until G2/M phase and then decreased. Isoform 3 is gradually expressed during the cell cycle until S phase and then decreased.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP021015HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen