« Zurück
Home /
Recombinant Human Synaptosomal-associated protein 29(SNAP29)

Recombinant Human Synaptosomal-associated protein 29(SNAP29)

Hersteller	Cusabio
Kategorie	Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	10ug
Host	E.coli
ArtNr	CSB-EP021874HU-10
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Neuroscience
Uniprot ID	O95721
Gene Names	SNAP29
Organism	Homo sapiens (Human)
AA Sequence	MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGP DAPADRQQYLRQEVLRRAEATAASTSRSLALMYES EKVGVASSEELARQRGVLERTEKMVDKMDQDLKIS QKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDP VPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLD VNIKSTERKVRQL
Expression Region	1-258aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	56 kDa
Alternative Name(s)	Soluble 29KDA NSF attachment protein Vesicle-membrane fusion protein SNAP-29
Relevance	SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.
Reference	"Three novel proteins of the syntaxin/SNAP-25 family." Steegmaier M., Yang B., Yoo J.-S., Huang B., Shen M., Yu S., Luo Y., Scheller R.H. J. Biol. Chem. 273:34171-34179(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.
Involvement in disease	Cerebral dysgenesis, neuropathy, ichthyosis, and palmoplantar keratoderma syndrome (CEDNIK)
Subcellular Location	Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic vesicle, autophagosome membrane, Peripheral membrane protein, Cell projection, cilium membrane, Peripheral membrane protein
Protein Families	SNAP-25 family
Tissue Specificity	Found in brain, heart, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas.
Paythway	Autophagy-animal
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen