Vergleich

Recombinant Mouse Tumor necrosis factor ligand superfamily member 11(Tnfsf11),partial

ArtNr CSB-EP023986MO-200
Hersteller Cusabio
Menge 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence YFRAQMDPNRISEDSTHCFYRILRLHENADLQDST LESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRF SGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASI PSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQ DGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKT SIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGF FKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQD ID
Protein Familie Tumor necrosis factor family
Citations "TRANCE is a novel ligand of the tumor necrosis factor receptor family that activates c-Jun N-terminal kinase in T cells."Wong B.R., Rho J., Arron J., Robinson E., Orlinick J., Chao M., Kalachikov S., Cayani E., Bartlett F.S. III, Frankel W.N., Lee S.Y., Choi Y.J. Biol. Chem. 272:25190-25194(1997)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Osteoclast differentiation factor,ODF,Osteoprotegerin ligand,OPGL,Receptor activator of nuclear factor kappa-B ligand,RANKL,TNF-related activation-induced cytokine,TRANCE,CD_antigen: CD254
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
43.9 kDa
Relevance
Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.
Expression Region
70-316aa
Protein Length
Extracellular Domain
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (By similarity). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts
Subcellular Location
Isoform 1: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 11, soluble form: Secreted
Tissue Specificity
Highly expressed in thymus and lymph nodes, but not in non-lymphoid tissues and is abundantly expressed in T-cells but not in B-cells. A high level expression is also seen in the trabecular bone and lung.
Involvement in disease
Deficiency in Tnfsf11 results in failure to form lobulo-alveolar mammary structures during pregnancy, resulting in death of newborns. Trance-deficient mice show severe osteopetrosis, with no osteoclasts, marrow spaces, or tooth eruption, and exhibit profound growth retardation at several skeletal sites, including the limbs, skull, and vertebrae and have marked chondrodysplasia, with thick, irregular growth plates and a relative increase in hypertrophic chondrocytes.
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen