« Zurück
Startseite /
Recombinant Treponema pallidum Periplasmic zinc-binding protein troA(troA)

Recombinant Treponema pallidum Periplasmic zinc-binding protein troA(troA)

ArtNr	CSB-EP309098TPR-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	FGSKDAAADGKPLVVTTIGMIADAVKNIAQGDVHL KGLMGPGVDPHLYTATAGDVEWLGNADLILYNGLH LETKMGEVFSKLRGSRLVVAVSETIPVSQRLSLEE AEFDPHVWFDVKLWSYSVKAVYESLCKLLPGKTRE FTQRYQAYQQQLDKLDAYVRRKAQSLPAERRVLVT AHDAFGYFSRAYGFEVKGLQGVSTASEASAHDMQE LAAFIAQRKLPAIFIESSIPHKNVEALRDAVQARG HVV
Protein Familie	Bacterial solute-binding protein 9 family
Citations	"The binary protein interactome of Treponema pallidum--the syphilis spirochete." Titz B., Rajagopala S.V., Goll J., Hauser R., McKevitt M.T., Palzkill T., Uetz P. PLoS ONE 3:e2292-e2292(2008)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tromp-1 (troMP1)
Lieferbar
Manufacturer - Targets	troA
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	38.2 kDa
General Research Areas	Signal Transduction
Relevance	Part of an ATP-driven transport system TroABCD for zinc. Substrate-binding protein involved in the transport of zinc across the cytoplasmic membrane. Caution
Expression Region	23-308aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Part of an ATP-driven transport system TroABCD for zinc. Substrate-binding protein involved in the transport of zinc across the cytoplasmic membrane.
Subcellular Location	Periplasm
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP309098TPR-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern