« Zurück
Startseite /
Recombinant Staphylococcus aureus Iron-regulated surface determinant protein B(isdB),partial

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein B(isdB),partial

ArtNr	CSB-EP313758SUM-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AAEETGGTNTEAQPKTEAVASPTTTSEKAPETKPV ANAVSVSNKEVEAPTSETKEAKEVKEVKAPKETKE VKPAAKATNNTYPILNQELREAIKNPAIKDKDHSA PNSRPIDFEMKKKDGTQQFYHYASSVKPARVIFTD SKPEIELGLQSGQFWRKFEVYEGDKKLPIKLVSYD TVKDYAYIRFSVSNGTKAVKIVSSTHFNNKEEKYD YTLMEFAQPIYNSADKFKT
Protein Familie	IsdB family
Citations	"Subtle genetic changes enhance virulence of methicillin resistant and sensitive Staphylococcus aureus."Highlander S.K., Hulten K.G., Qin X., Jiang H., Yerrapragada S., Mason E.O. Jr., Shang Y., Williams T.M., Fortunov R.M., Liu Y., Igboeli O., Petrosino J., Tirumalai M., Uzman A., Fox G.E., Cardenas A.M., Muzny D.M., Hemphill L. Weinstock G.M.BMC Microbiol. 7:99-99(2007).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fur-regulated protein B,Staphylococcal iron-regulated protein H,Staphylococcus aureus surface protein J
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	41.6 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Microbiology
Relevance	Seems to function as the primary receptor for hemoglobin since its inactivation inhibits the ability of S.aureus to bind hemoglobin. Binds hemoglobin in a dose-dependent way. Required for S.aureus growth using hemoglobin as the sole iron source. Also required for virulence. IsdA and/or IsdB promote resistance to hydrogen peroxide and killing by neutrophils (By similarity).
Expression Region	41-269aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Seems to function as the primary receptor for hemoglobin since its inactivation inhibits the ability of S.aureus to bind hemoglobin. Binds hemoglobin in a dose-dependent way. Required for S.aureus growth using hemoglobin as the sole iron source. Also required for virulence. IsdA and/or IsdB promote resistance to hydrogen peroxide and killing by neutrophils (By similarity).
Subcellular Location	Secreted, cell wall, Peptidoglycan-anchor
Gene Names	isdB
Sequence Info	Partial
Organism	Staphylococcus aureus (strain USA300 / TCH1516)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP313758SUM-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern