« Zurück
Startseite /
Recombinant Glycine max 2S albumin

Recombinant Glycine max 2S albumin

ArtNr	CSB-EP324829GGV-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGD DDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEE GHMQKCCTEMSELRSPKCQCKALQKIMENQSEELE EKQKKKMEKELINLATMCRFGPMIQCDLSSDD
Protein Familie	2S seed storage albumins family
Citations	A soybean cDNA encoding a chromatin-binding peptide inhibits mitosis of mammalian cells.Galvez A.F., de Lumen B.O.Nat. Biotechnol. 17:495-500(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	32.2 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	This is a 2S seed storage protein.
Expression Region	22-158aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	This is a 2S seed storage protein.
Tissue Specificity	Expressed in cotyledons (Ref.2). Maximal expression in parenchyma cells undergoing DNA endoreduplication and cell expansion but not in actively dividing cells of the cotyledon (PubMed:10331812).
Gene Names	GM2S-1
Sequence Info	Full Length of Mature Protein
Organism	Glycine max (Soybean) (Glycine hispida)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP324829GGV-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 15.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern