« Zurück
Startseite /
Recombinant Glycine max Ribulose bisphosphate carboxylase large chain(rbcL)

Recombinant Glycine max Ribulose bisphosphate carboxylase large chain(rbcL)

ArtNr	CSB-EP328678GGV-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	PQTETKASVGFKAGVKDYKLTYYTPDYETKDTDIL AAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTD GLTSLDRYKGRCYGLEPVAGEENQYIAYVAYPLDL FEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPT AYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPK LGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFM RWRDRFLFCAEAIFKSQAETGEIKGHYLNATAGTC EEM
Protein Familie	RuBisCO large chain family, Type I subfamily
Citations	Complete chloroplast genome sequence of Glycine max and comparative analyses with other legume genomes.Saski C., Lee S.-B., Daniell H., Wood T.C., Tomkins J., Kim H.-G., Jansen R.K.Plant Mol. Biol. 59:309-322(2005).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RuBisCO large subunit
Lieferbar
Manufacturer - Targets	rbcL
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	68.4 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Signal Transduction
Relevance	RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1, 5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site.
Expression Region	3-475aa
Protein Length	Full Length of Mature Protein
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	RuBisCO catalyzes two reactions
Subcellular Location	Plastid, chloroplast
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP328678GGV-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 15.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern