Vergleich

Recombinant Hepatitis C virus genotype 1a Genome polyprotein,partial

ArtNr CSB-EP333180HFD-500
Hersteller Cusabio
Menge 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Konjugat/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGC VPCVREGNASRCWVAMTPTVATRDGKLPATQLRRH IDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPR RHWTTQGCNCSIYPGHITGHRMAWDMMMN
Protein Familie Hepacivirus polyprotein family
Citations Infectious cDNA clone of the hepatitis C virus genotype 1 prototype sequence.Lanford R.E., Lee H., Chavez D., Guerra B., Brasky K.M.J. Gen. Virol. 82:1291-1297(2001)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
30.7 kDa
Buffer
Tris-based buffer, 50% glycerol
Relevance
Core protein packages viral RNA to form a viral nucleocapsid, and promotes virion budding. Modulates viral translation initiation by interacting with HCV IRES and 40S ribosomal subunit. Also regulates many host cellular functions such as signaling pathways and apoptosis. Prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) and IFN-gamma signaling pathways and by inducing human STAT1 degradation. Thought to play a role in virus-mediated cell transformation leading to hepatocellular carcinomas. Interacts with, and activates STAT3 leading to cellular transformation. May repress the promoter of p53, and sequester CREB3 and SP110 isoform 3/Sp110b in the cytoplasm. Also represses cell cycle negative regulating factor CDKN1A, thereby interrupting an important check point of normal cell cycle regulation. Targets transcription factors involved in the regulation of inflammatory responses and in the immune response: suppresses NK-kappaB activation, and activates AP-1. Could mediate apoptotic pathways through association with TNF-type receptors TNFRSF1A and LTBR, although its effect on death receptor-induced apoptosis rains controversial. Enhances TRAIL mediated apoptosis, suggesting that it might play a role in immune-mediated liver cell injury. Seric core protein is able to bind C1QR1 at the T-cell surface, resulting in down-regulation of T-lymphocytes proliferation. May transactivate human MYC, Rous sarcoma virus LTR, and SV40 promoters. May suppress the human FOS and HIV-1 LTR activity. Alters lipid metabolism by interacting with hepatocellular proteins involved in lipid accumulation and storage. Core protein induces up-regulation of FAS promoter activity, and thereby probably contributes to the increased triglyceride accumulation in hepatocytes (steatosis) .E1 and E2 glycoproteins form a heterodimer that is involved in virus attachment to the host cell, virion internalization through clathrin-dependent endocytosis and fusion with host mbrane. E1/E2 heterodimer binds to human LDLR, CD81 and SCARB1/SR-BI receptors, but this binding is not sufficient for infection, some additional liver specific cofactors may be needed. The fusion function may possibly be carried by E1. E2 inhibits human EIF2AK2/PKR activation, preventing the establishment of an antiviral state. E2 is a viral ligand for CD209/DC-SIGN and CLEC4M/DC-SIGNR, which are respectively found on dendritic cells (DCs), and on liver sinusoidal endothelial cells and macrophage-like cells of lymph node sinuses. These interactions allow capture of circulating HCV particles by these cells and subsequent transmission to permissive cells. DCs act as sentinels in various tissues where they entrap pathogens and convey th to local lymphoid tissue or lymph node for establishment of immunity. Capture of circulating HCV particles by these SIGN+ cells may facilitate virus infection of proximal hepatocytes and lymphocyte subpopulations and may be essential for the establishment of persistent infection.P7 ses to be a heptameric ion channel protein (viroporin) and is inhibited by the antiviral drug amantadine. Also inhibited by long-alkyl-chain iminosugar derivatives. Essential for infectivity .Protease NS2-3 is a cysteine protease responsible for the autocatalytic cleavage of NS2-NS3. Ses to undergo self-inactivation following maturation.NS3 displays three enzymatic activities: serine protease, NTPase and RNA helicase. NS3 serine protease, in association with NS4A, is responsible for the cleavages of NS3-NS4A, NS4A-NS4B, NS4B-NS5A and NS5A-NS5B. NS3/NS4A complex also prevents phosphorylation of human IRF3, thus preventing the establishment of dsRNA induced antiviral state. NS3 RNA helicase binds to RNA and unwinds dsRNA in the 3' to 5' direction, and likely RNA stable secondary structure in the tplate strand. Cleaves and inhibits the host antiviral protein MAVS .NS4B induces a specific mbrane alteration that serves as a scaffold for the virus replication complex. This mbrane alteration gives rise to the so-called ER-derived mbranous web that contains the replication complex .NS5A is a component of the replication complex involved in RNA-binding. Its interaction with Human VAPB may target the viral replication complex to vesicles. Down-regulates viral IRES translation initiation. Mediates interferon resistance, presumably by interacting with and inhibiting human EIF2AK2/PKR. Ses to inhibit apoptosis by interacting with BIN1 and FKBP8. The hyperphosphorylated form of NS5A is an inhibitor of viral replication .NS5B is an RNA-dependent RNA polymerase that plays an essential role in the virus replication.
Expression Region
192-325aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Core protein packages viral RNA to form a viral nucleocapsid, and promotes virion budding. Modulates viral translation initiation by interacting with HCV IRES and 40S ribosomal subunit. Also regulates many host cellular functions such as signaling pathways and apoptosis. Prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) and IFN-gamma signaling pathways and by inducing human STAT1 degradation. Thought to play a role in virus-mediated cell transformation leading to hepatocellular carcinomas. Interacts with, and activates STAT3 leading to cellular transformation. May repress the promoter of p53, and sequester CREB3 and SP110 isoform 3/Sp110b in the cytoplasm. Also represses cell cycle negative regulating factor CDKN1A, thereby interrupting an important check point of normal cell cycle regulation. Targets transcription factors involved in the regulation of inflammatory responses and in the immune response
Subcellular Location
Core protein p21: Host endoplasmic reticulum membrane, Single-pass membrane protein, Host mitochondrion membrane, Single-pass type I membrane protein, Host lipid droplet, Note=The C-terminal transmembrane domain of core protein p21 contains an ER signal leading the nascent polyprotein to the ER membrane, Only a minor proportion of core protein is present in the nucleus and an unknown proportion is secreted, SUBCELLULAR LOCATION: Core protein p19: Virion, Host cytoplasm, Host nucleus, Secreted, SUBCELLULAR LOCATION: Envelope glycoprotein E1: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum membrane, Single-pass type I membrane protein, Note=The C-terminal transmembrane domain acts as a signal sequence and forms a hairpin structure before cleavage by host signal peptidase, After cleavage, the membrane sequence is retained at the C-terminus of the protein, serving as ER membrane anchor, A reorientation of the second hydrophobic stretch occurs after cleavage producing a single reoriented transmembrane domain, These events explain the final topology of the protein, ER retention of E1 is leaky and, in overexpression conditions, only a small fraction reaches the plasma membrane, SUBCELLULAR LOCATION: Envelope glycoprotein E2: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum membrane, Single-pass type I membrane protein, Note=The C-terminal transmembrane domain acts as a signal sequence and forms a hairpin structure before cleavage by host signal peptidase, After cleavage, the membrane sequence is retained at the C-terminus of the protein, serving as ER membrane anchor, A reorientation of the second hydrophobic stretch occurs after cleavage producing a single reoriented transmembrane domain, These events explain the final topology of the protein, ER retention of E2 is leaky and, in overexpression conditions, only a small fraction reaches the plasma membrane, SUBCELLULAR LOCATION: p7: Host endoplasmic reticulum membrane, Multi-pass membrane protein, Host cell membrane, Note=The C-terminus of p7 membrane domain acts as a signal sequence, After cleavage by host signal peptidase, the membrane sequence is retained at the C-terminus of the protein, serving as ER membrane anchor, Only a fraction localizes to the plasma membrane, SUBCELLULAR LOCATION: Protease NS2-3: Host endoplasmic reticulum membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Serine protease NS3: Host endoplasmic reticulum membrane, Peripheral membrane protein, Note=NS3 is associated to the ER membrane through its binding to NS4A, SUBCELLULAR LOCATION: Non-structural protein 4A: Host endoplasmic reticulum membrane, Single-pass type I membrane protein, Note=Host membrane insertion occurs after processing by the NS3 protease, SUBCELLULAR LOCATION: Non-structural protein 4B: Host endoplasmic reticulum membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Non-structural protein 5A: Host endoplasmic reticulum membrane, Peripheral membrane protein, Host cytoplasm, host perinuclear region, Host mitochondrion, Note=Host membrane insertion occurs after processing by the NS3 protease, SUBCELLULAR LOCATION: RNA-directed RNA polymerase: Host endoplasmic reticulum membrane, Single-pass type I membrane protein
Sequence Info
Partial
Organism
Hepatitis C virus genotype 1a (isolate 1) (HCV)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen