« Zurück
Startseite /
Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB(porB)

Recombinant Neisseria meningitidis serogroup B Major outer membrane protein P.IB(porB)

ArtNr	CSB-EP335569NBK-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	DVTLYGTIKAGVETSRSVAHNGAQAASVETGTGIV DLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDS GWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINP WDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSG SVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGG AYKRHHQVQENVNIEKYQIHRLVSGYDNDALYASV AVQQQDAKLVEENYSHNSQTEVAATLAYRFGNVTP RVS
Protein Familie	Gram-negative porin family
Citations	"Sequence analysis and relationships between meningococcal class 3 serotype proteins and other porins from pathogenic and non-pathogenic Neisseria species." Ward M.J., Lambden P.R., Heckels J.E. FEMS Microbiol. Lett. 73:283-289(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Class 3 protein; Porin
Lieferbar
Manufacturer - Targets	porB
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	37.8 kDa
General Research Areas	Signal Transduction
Relevance	Serves as a slightly cation selective porin. GO - Molecular functioni
Expression Region	20-331aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Serves as a slightly cation selective porin.
Subcellular Location	Cell outer membrane, Multi-pass membrane protein
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP335569NBK-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern