« Zurück
Startseite /
Recombinant Escherichia coli FKBP-type peptidyl-prolyl cis-trans isomerase fkpA(fkpA)

Recombinant Escherichia coli FKBP-type peptidyl-prolyl cis-trans isomerase fkpA(fkpA)

ArtNr	CSB-EP338214ENV-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	AEAAKPATAADSKAAFKNDDQKSAYALGASLGRYM ENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSD QEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKE YREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSD TVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIP GWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPP NSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK
Protein Familie	FKBP-type PPIase family
Citations	"Escherichia coli and other species of the Enterobacteriaceae encode a protein similar to the family of Mip-like FK506-binding proteins." Horne S.M., Young K.D. Arch. Microbiol. 163:357-365(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Rotamase,yzzS
Lieferbar
Manufacturer - Targets	fkpA
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	33.2 kDa
Relevance	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Expression Region	26-270aa
Protein Length	Full Length of Mature Protein
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Subcellular Location	Periplasm
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP338214ENV-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 23.10.2025