« Zurück
Home /
Recombinant Moloney murine leukemia virus Gag polyprotein(gag) ,partial

Recombinant Moloney murine leukemia virus Gag polyprotein(gag) ,partial

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP356017MHK-1
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Microbiology
Uniprot ID	P03332
Gene Names	gag
Organism	Moloney murine leukemia virus (isolate Shinnick) (MoMLV)
AA Sequence	PLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPG KLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQR VLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWD YTTQAGRNHLVHYRQLLLAGLQNAGRSPTNLAKVK GITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQE TNVSMSFIWQSAPDIGRKLERLEDLKNKTLGDLVR EAEKIFNKRETPEEREERIRRETEEKEERRRTEDE QKEKERDRRRHREMSKLL
Expression Region	216-478aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	46.6 kDa
Alternative Name(s)	Core polyprotein Cleaved into the following 4 chains: Matrix protein p15 Short name: MA RNA-binding phosphoprotein p12 Alternative name(s): pp12 Capsid protein p30 Short name: CA Nucleocapsid protein p10 Short name: NC-gag
Relevance	Gag polyprotein plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably link the viral protein to the host ESCRT pathway and facilitate release.
Reference	Late domain-independent rescue of a release-deficient Moloney murine leukemia virus by the ubiquitin ligase Itch.Jadwin J.A., Rudd V., Sette P., Challa S., Bouamr F.J. Virol. 84:704-715(2010)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Gag polyprotein
Subcellular Location	Gag polyprotein: Virion, Host cell membrane, Lipid-anchor, Host late endosome membrane, Lipid-anchor, Host endosome, host multivesicular body, Note=These locations are probably linked to virus assembly sites, SUBCELLULAR LOCATION: Matrix protein p15: Virion, SUBCELLULAR LOCATION: Capsid protein p30: Virion, SUBCELLULAR LOCATION: Nucleocapsid protein p10-Gag: Virion, SUBCELLULAR LOCATION: RNA-binding phosphoprotein p12: Host cytoplasm
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP356017MHK-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen