Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
1mg |
Host |
E.coli |
Item no. |
CSB-EP356017MHK-1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Areas |
Microbiology |
Uniprot ID |
P03332 |
Gene Names |
gag |
Organism |
Moloney murine leukemia virus (isolate Shinnick) (MoMLV) |
AA Sequence |
PLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPG KLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQR VLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWD YTTQAGRNHLVHYRQLLLAGLQNAGRSPTNLAKVK GITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQE TNVSMSFIWQSAPDIGRKLERLEDLKNKTLGDLVR EAEKIFNKRETPEEREERIRRETEEKEERRRTEDE QKEKERDRRRHREMSKLL |
Expression Region |
216-478aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
46.6 kDa |
Alternative Name(s) |
Core polyprotein Cleaved into the following 4 chains: Matrix protein p15 Short name: MA RNA-binding phosphoprotein p12 Alternative name(s): pp12 Capsid protein p30 Short name: CA Nucleocapsid protein p10 Short name: NC-gag |
Relevance |
Gag polyprotein plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably link the viral protein to the host ESCRT pathway and facilitate release. |
Reference |
Late domain-independent rescue of a release-deficient Moloney murine leukemia virus by the ubiquitin ligase Itch.Jadwin J.A., Rudd V., Sette P., Challa S., Bouamr F.J. Virol. 84:704-715(2010) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Gag polyprotein |
Subcellular Location |
Gag polyprotein: Virion, Host cell membrane, Lipid-anchor, Host late endosome membrane, Lipid-anchor, Host endosome, host multivesicular body, Note=These locations are probably linked to virus assembly sites, SUBCELLULAR LOCATION: Matrix protein p15: Virion, SUBCELLULAR LOCATION: Capsid protein p30: Virion, SUBCELLULAR LOCATION: Nucleocapsid protein p10-Gag: Virion, SUBCELLULAR LOCATION: RNA-binding phosphoprotein p12: Host cytoplasm |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.