« Back
Home /
Recombinant Moloney murine leukemia virus Gag polyprotein(gag) ,partial

Recombinant Moloney murine leukemia virus Gag polyprotein(gag) ,partial

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	E.coli
Item no.	CSB-EP356017MHK-1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Microbiology
Uniprot ID	P03332
Gene Names	gag
Organism	Moloney murine leukemia virus (isolate Shinnick) (MoMLV)
AA Sequence	PLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPG KLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQR VLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWD YTTQAGRNHLVHYRQLLLAGLQNAGRSPTNLAKVK GITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQE TNVSMSFIWQSAPDIGRKLERLEDLKNKTLGDLVR EAEKIFNKRETPEEREERIRRETEEKEERRRTEDE QKEKERDRRRHREMSKLL
Expression Region	216-478aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	46.6 kDa
Alternative Name(s)	Core polyprotein Cleaved into the following 4 chains: Matrix protein p15 Short name: MA RNA-binding phosphoprotein p12 Alternative name(s): pp12 Capsid protein p30 Short name: CA Nucleocapsid protein p10 Short name: NC-gag
Relevance	Gag polyprotein plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably link the viral protein to the host ESCRT pathway and facilitate release.
Reference	Late domain-independent rescue of a release-deficient Moloney murine leukemia virus by the ubiquitin ligase Itch.Jadwin J.A., Rudd V., Sette P., Challa S., Bouamr F.J. Virol. 84:704-715(2010)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Gag polyprotein
Subcellular Location	Gag polyprotein: Virion, Host cell membrane, Lipid-anchor, Host late endosome membrane, Lipid-anchor, Host endosome, host multivesicular body, Note=These locations are probably linked to virus assembly sites, SUBCELLULAR LOCATION: Matrix protein p15: Virion, SUBCELLULAR LOCATION: Capsid protein p30: Virion, SUBCELLULAR LOCATION: Nucleocapsid protein p10-Gag: Virion, SUBCELLULAR LOCATION: RNA-binding phosphoprotein p12: Host cytoplasm
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP356017MHK-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time