« Zurück
Home /
Recombinant Bacillus subtilis Subtilisin E(aprE)

Recombinant Bacillus subtilis Subtilisin E(aprE)

ArtNr	CSB-EP356214BRJ-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AQSVPYGISQIKAPALHSQGYTGSNVKVAVIDSGI DSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAG TIAALNNSIGVLGVAPSASLYAVKVLDSTGSGQYS WIINGIEWAISNNMDVINMSLGGPTGSTALKTVVD KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTI AVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQ VRD
Protein Familie	Peptidase S8 family
Citations	Replacement of the Bacillus subtilis subtilisin structural gene with an In vitro-derived deletion mutation.Stahl M.L., Ferrari E.J. Bacteriol. 158:411-418(1984)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.7 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Subtilisin is an Extracellular domain alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
Expression Region	107-381aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
Subcellular Location	Secreted
Gene Names	aprE
Sequence Info	Full Length of Mature Protein
Organism	Bacillus subtilis (strain 168)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP356214BRJ-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 05.06.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail