« Zurück
Startseite /
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

ArtNr	CSB-EP357829TIFa0-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIP LLRSSLPGSQRYALIHLTNYADETISVAIDVTNVY IMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTL PYSGNYERLQTAAGKIRENIPLGLPALDSAITTLF YYNANSAASALMVLIQSTSEAARYKFIEQQIGKRV DKTFLPSLAIISLENSWSALSKQIQIASTNNGQFE SPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNN MA
Protein Familie	Ribosome-inactivating protein family, Type 1 RIP subfamily
Citations	"Isolation and DNA sequence of a gene encoding alpha-trichosanthin, a type I ribosome-inactivating protein." Chow T., Feldman R.A., Lovett M., Piatak M. J. Biol. Chem. 265:8670-8674(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	rRNA N-glycosidase (Alpha-TCS)
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	33.1 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Inactivates eukaryotic 60S ribosomal subunits.
Expression Region	24-270aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inactivates eukaryotic 60S ribosomal subunits.
Sequence Info	Full Length of Mature Protein
Organism	Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP357829TIFa0-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern