Vergleich

Recombinant Staphylococcus aureus Replication initiation protein(repD)

ArtNr CSB-EP360946FKZ-50
Hersteller Cusabio
Menge 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSTENHSNYLQNKDLDNFSKTGYSNSRLSGNFFTT PQPELSFDAMTIVGNLNKTNAKKLSDFMSTEPQIR LWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNM RVEFNPNKLTHEEMLWLKQNIIDYMEDDGFTRLDL AFDFEDDLSDYYAMTDKAVKKTIFYGRNGKPETKY FGVRDSDRFIRIYNKKQERKDNADVEVMSEHLWRV EIELKRDMVDYWNDCFDDLHILKPDWTTPEKVKEQ AMV
Protein Familie Plasmid replication initiation factor family
Citations "The use of synthetic oligonucleotides with universal templates for rapid DNA sequencing: results with staphylococcal replicon pC221."
Brenner D.G., Shaw W.V.EMBO J. 4:561-568(1985)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
53.5 kDa
Buffer
Tris-based buffer, 50% glycerol
Relevance
This protein is probably a specific topoisomerase involved in initiating replication. This protein is specifically required and may be rate-limiting for replication of the plasmid in vivo.
Expression Region
1-311aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This protein is probably a specific topoisomerase involved in initiating replication. This protein is specifically required and may be rate-limiting for replication of the plasmid in vivo.
Gene Names
repD
Sequence Info
Full Length
Organism
Staphylococcus aureus
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen