Vergleich

Recombinant Epstein-Barr virus Envelope glycoprotein GP350(BLLF1),partial

ArtNr CSB-EP360986EFA-10
Hersteller Cusabio
Menge 10 ug
Quantity options 1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Human (Homo sapiens)
Host E.coli
Konjugat/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEAALLVCQYTIQSLIHLTGEDPGFFNVEIPEFPF YPTCNVCTADVNVTINFDVGGKKHQLDLDFGQLTP HTKAVYQPRGAFGGSENATNLFLLELLGAGELALT MRSKKLPINVTTGEEQQVSLESVDVYFQDVFGTMW CHHAEMQNPVYLIPETVPYIKWDNCNSTNITAVVR AQGLDVTLPLSLPTSAQDSNFSVKTEMLGNEIDIE CIMEDGEISQVLPGDNKFNITCSGYESHVPSGGIL TST
Protein Familie Epstein-Barr GP350 family
Citations Two major outer envelope glycoproteins of Epstein-Barr virus are encoded by the same gene.Beisel C., Tanner J., Matsuo T., Thorley-Lawson D., Kezdy F., Kieff E.J. Virol. 54:665-674(1985)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Membrane antigen; Short name:; MA
Lieferbar
Manufacturer - Targets
BLLF1
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
68.5 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Initiates virion attachment to host B-lymphocyte cell, leading to virus entry. Acts by binding to host CR2 at the surface of B-lymphocytes, facilitating the binding of viral glycoprotein gp42 to HLA class II molecules. Attachment triggers virion-host membrane fusion and invasion of the host cell.
Biologically Active
Not Test
Expression Region
1-493aa
Protein Length
Partial
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Initiates virion attachment to host B-lymphocyte cell, leading to virus entry. Acts by binding to host CR2 at the surface of B-lymphocytes, facilitating the binding of viral glycoprotein gp42 to HLA class II molecules. Attachment triggers virion-host membrane fusion and invasion of the host cell.
Subcellular Location
Virion membrane, Single-pass membrane protein, Host membrane, Single-pass membrane protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen