« Zurück
Startseite /
Recombinant Pseudomonas sp. Carboxypeptidase G2(cpg2)

Recombinant Pseudomonas sp. Carboxypeptidase G2(cpg2)

ArtNr	CSB-EP361895PVV-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGT GDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVG DNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPF RVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVR DYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVL SFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGA APELGVNALVEASDLVLRTMNIDDKAKNLRFNWTI AKA
Protein Familie	Peptidase M20A family
Citations	Crystal structure of carboxypeptidase G2, a bacterial enzyme with applications in cancer therapy.Rowsell S., Pauptit R.A., Tucker A.D., Melton R.G., Blow D.M., Brick P.Structure 5:337-347(1997)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Folate hydrolase G2Glutamate carboxypeptidasePteroylmonoglutamic acid hydrolase G2INN: Glucarpidase
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	68.7 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.
Expression Region	23-415aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the hydrolysis of reduced and non-reduced folates to pteroates and L-glutamate. This enzyme has a broad specificity.
Gene Names	cpg2
Sequence Info	Full Length of Mature Protein
Organism	Pseudomonas sp. (strain RS-16)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP361895PVV-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern