« Zurück
Startseite /
Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)

ArtNr	CSB-EP362349ENV-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLV VDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSN FSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPV ALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSD DFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDY PGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFT NTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGT SAV
Protein Familie	Fimbrial protein family
Citations	Three fim genes required for the regulation of length and mediation of adhesion of Escherichia coli type 1 fimbriae.Klemm P., Christiansen G.Mol. Gen. Genet. 208:439-445(1987)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Targets	fimH
Manufacturer - Conjugate / Tag	N-terminal 6xHis-GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	59.1 kDa
Relevance	Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
Expression Region	22-300aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
Subcellular Location	Fimbrium
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP362349ENV-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern