« Zurück
Startseite /
Recombinant Porphyromonas gingivalis Lys-gingipain(kgp),partial

Recombinant Porphyromonas gingivalis Lys-gingipain(kgp),partial

ArtNr	CSB-EP464342EXZ-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	DVYTDHGDLYNTPVRMLVVAGAKFKEALKPWLTWK AQKGFYLDVHYTDEAEVGTTNASIKAFIHKKYNDG LAASAAPVFLALVGDTDVISGEKGKKTKKVTDLYY SAVDGDYFPEMYTFRMSASSPEELTNIIDKVLMYE KATMPDKSYLEKALLIAGADSYWNPKIGQQTIKYA VQYYYNQDHGYTDVYSYPKAPYTGCYSHLNTGVGF ANYTAHGSETSWADPSLTATQVKALTNKDKYFLAI GNC
Protein Familie	Peptidase C25 family
Citations	"Biochemical and functional properties of lysine-specific cysteine proteinase (Lys-gingipain) as a virulence factor of Porphyromonas gingivalis in periodontal disease."Abe N., Kadowaki T., Okamoto K., Nakayama K., Ohishi M., Yamamoto K.J. Biochem. 123:305-312(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Lysine-specific cysteine proteinase Kgp
Lieferbar
Manufacturer - Targets	kgp
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	56.6 kDa
Relevance	Cysteine proteinase with a strong preference for substrates with Lys in the P1 position. Hydrolyzes bovine hemoglobin, bovine serum albumin, casein, human placental type I collagen and human IgA and IgG. Disrupts the functions of polymorphonuclear leukocytes. May act as a virulence factor in the development of peridontal disease. Involved in the coaggregation of P.gingivalis with other oral bacteria.
Expression Region	229-594aa
Protein Length	Partial
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cysteine proteinase with a strong preference for substrates with Lys in the P1 position. Hydrolyzes bovine hemoglobin, bovine serum albumin, casein, human placental type I collagen and human IgA and IgG. Disrupts the functions of polymorphonuclear leukocytes. May act as a virulence factor in the development of peridontal disease. Involved in the coaggregation of P.gingivalis with other oral bacteria.
Subcellular Location	Lys-gingipain catalytic subunit: Secreted, extracellular space
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP464342EXZ-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 15.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern