« Zurück
Startseite /
Recombinant Dermatophagoides pteronyssinus Tropomyosin

Recombinant Dermatophagoides pteronyssinus Tropomyosin

ArtNr	CSB-EP517721DJH-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MEAIKNKMQAMKLEKDNAIDRAEIAEQKARDANLR AEKSEEEVRALQKKIQQIENELDQVQEQLSAANTK LEEKEKALQTAEGDVAALNRRIQLIEEDLERSEER LKIATAKLEEASQSADESERMRKMLEHRSITDEER MEGLENQLKEARMMAEDADRKYDEVARKLAMVEAD LERAEERAETGESKIVELEEELRVVGNNLKSLEVS EEKAQQREEAHEQQIRIMTTKLKEAEARAEFAERS VQK
Protein Familie	Tropomyosin family
Citations	"Sequencing and high level expression in Escherichia coli of the tropomyosin allergen (Der p 10) from Dermatophagoides pteronyssinus." Asturias J.A., Arilla M.C., Gomez-Bayon N., Martinez J., Martinez A., Palacios R.Biochim. Biophys. Acta 1397:27-30(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Allergen: Der p 10
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	48.9 kDa
General Research Areas	Signal Transduction
Relevance	Tropomyosin, in association with the troponin complex, plays a central role in the calcium dependent regulation of muscle contraction.
Expression Region	1-284aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Tropomyosin, in association with the troponin complex, plays a central role in the calcium dependent regulation of muscle contraction.
Sequence Info	Full Length
Organism	Dermatophagoides pteronyssinus (European house dust mite)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP517721DJH-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern