« Zurück
Startseite /
Recombinant Mouse Diazepam-binding inhibitor-like 5(Dbil5)

Recombinant Mouse Diazepam-binding inhibitor-like 5(Dbil5)

ArtNr	CSB-EP520959MO-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Drugs Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQA TQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDA MRIYIAKVEELKKKEPC
Protein Familie	ACBP family
Citations	"Progressive inactivation of the haploid expressed gene for the sperm-specific endozepine-like peptide (ELP) through primate evolution." Ivell R., Pusch W., Balvers M., Valentin M., Walther N., Weinbauer G. Gene 255:335-345(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Endozepine-like peptide
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	13.9 kDa
Relevance	May be involved in the energy metabolism of the mature sperm.
Expression Region	1-87aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in the energy metabolism of the mature sperm.
Subcellular Location	Cytoplasm
Tissue Specificity	Exclusively expressed in late spermatids and spermatozoa. Not found in epididymis, spleen, bone marrow, skin, liver, brain, heart, kidney, muscle.
Gene Names	Dbil5
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP520959MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern