« Zurück
Startseite /
Recombinant Halobacterium salinarum Cobalamin-binding protein(btuF)

Recombinant Halobacterium salinarum Cobalamin-binding protein(btuF)

ArtNr	CSB-EP534746HTL-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	LAPQPPAQHADADRACSFPVTEPDASNTAITLDSE PERVVTLNPSAAQTMWELGDRDAVVGVSQFGTYLP TASQRTVVSGGQPSQTNVEAVVGLDPDLVLAPNTV RNTTVTRLRSAGITVFQFRAATSIDGVVEKTATIG RLTGNCAAAAATTAEMRDRVAAIADAVPDTDSARP RVYYHLGDGYTAGPNTFIGAAIEAAGGHNIAADVN TTSSYPQLSEEVIVSQDPDVVVTGVSADRLDATAS ALV
Citations	"Evolution in the laboratory: the genome of Halobacterium salinarum strain R1 compared to that of strain NRC-1." Pfeiffer F., Schuster S.C., Broicher A., Falb M., Palm P., Rodewald K., Ruepp A., Soppa J., Tittor J., Oesterhelt D. Genomics 91:335-346(2008)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Vitamin B12-binding protein
Lieferbar
Manufacturer - Conjugate / Tag	Tag-Free
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	35.3 kDa
Relevance	Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin import. Probably binds cobalamin and delivers it to the surface of BtuC.
Expression Region	25-369aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably binds cobalamin and delivers it to the surface of BtuC (By similarity).
Gene Names	btuF
Sequence Info	Full Length of Mature Protein
Organism	Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP534746HTL-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern