« Zurück
Home /
Recombinant Human Mucosal addressin cell adhesion molecule 1(MADCAM1),partial

Recombinant Human Mucosal addressin cell adhesion molecule 1(MADCAM1),partial

Hersteller	Cusabio
Kategorie	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP618776HU-500
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Immunology
Uniprot ID	Q13477
Gene Names	MADCAM1
Organism	Homo sapiens (Human)
AA Sequence	QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACAD RGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSA AGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPA ALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQEL EGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPP LGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPT SPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPE PPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQA GPTQGEVIPTGSSKPAGDQ
Expression Region	19-317aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	47.4 kDa
Alternative Name(s)	Short name: MAdCAM-1 Short name: hMAdCAM-1
Relevance	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Reference	"Cloning of the mucosal addressin MAdCAM-1 from human brain: identification of novel alternatively spliced transcripts."Leung E., Greene J., Ni J., Raymond L.G., Lehnert K., Langley R., Krissansen G.W.Immunol. Cell Biol. 74:490-496(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Subcellular Location	Membrane, Single-pass type I membrane protein
Tissue Specificity	Highly expressed on high endothelial venules (HEV) and lamina propia venules found in the small intestine, and to a lesser extent in the colon and spleen. Very low levels of expression found in pancreas and brain. Not expressed in the thymus, prostate, ovaries, testis, heart, placenta, lung, liver, skeletal muscle, kidney or peripheral blood leukocytes.
Tag Information	N-terminal 6xHis-SUMO-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP618776HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen