Vergleich

Recombinant Carcinoscorpius rotundicauda Limulus clotting factor C,partial

ArtNr CSB-EP638870CDQ-10
Hersteller Cusabio
Menge 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Konjugat/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SSQPSTVDLASKVKLPEGHYRVGSRAIYTCESRYY ELLGSQGRRCDSNGNWSGRPASCIPVCGRSDSPRS PFIWNGNSTEIGQWPWQAGISRWLADHNMWFLQCG GSLLNEKWIVTAAHCVTYSATAEIIDPNQFKMYLG KYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFD IALIQLKTPVTLTTRVQPICLPTDITTREHLKEGT LAVVTGWGLNENNTYSETIQQAVLPVVAASTCEEG YKE
Protein Familie Peptidase S1 family
Citations "Molecular cloning and sequence analysis of factor C cDNA from the Singapore horseshoe crab, Carcinoscorpius rotundicauda."
Ding J.L., Navas M.A. III, Ho B.
Mol. Mar. Biol. Biotechnol. 4:90-103(1995)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
42.2 kDa
Buffer
Tris-based buffer, 50% glycerol
Relevance
This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of factor B.
Expression Region
691-1019aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This enzyme is closely associated with an endotoxin-sensitive hemolymph coagulation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of factor B.
Subcellular Location
Secreted
Sequence Info
Partial
Organism
Carcinoscorpius rotundicauda (Mangrove horseshoe crab) (Limulus rotundicauda)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen