« Zurück
Startseite /
Recombinant Mouse Cytochrome P450 3A13(Cyp3a13)

Recombinant Mouse Cytochrome P450 3A13(Cyp3a13)

ArtNr	CSB-EP731056MO-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Mycotoxins Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MDLIPNFSMETWMLLATSLVLLYLYGTHSHGIFKK LGIPGPKPLPFLGTILAYQKGFWECDIQCHKKYGK MWGLYDGRQPVLAITDPDIIKTVLVKECYSTFTNR RRFGPVGILKKAISISENEEWKRIRALLSPTFTSG RLKEMFPIINQFTDVLVRNMRQGLGEGKPTSMKDI FGAYSMDVITATSFGVNIDSLNNPQDPFVEKIKKL LKFDIFDPLFLSVTLFPFLTPVFDALNVSLFPRDV ISF
Protein Familie	Cytochrome P450 family
Citations	"Molecular cloning and functional expression of a mouse cytochrome P-450 (Cyp3a-13): examination of Cyp3a-13 enzyme to activate aflatoxin B1 (AFB1)."Yanagimoto T., Itoh S., Sawada M., Hashimoto H., Kamataki T.Biochim. Biophys. Acta 1201:405-410(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CYPIIIA13
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	73.5 kDa
Relevance	Can activate aflatoxin B1 to a genotoxic product.
Expression Region	1-503aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Can activate aflatoxin B1 to a genotoxic product.
Subcellular Location	Endoplasmic reticulum membrane, Peripheral membrane protein, Microsome membrane, Peripheral membrane protein
Gene Names	Cyp3a13
Sequence Info	Full Length
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP731056MO-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 14.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern