« Zurück
Startseite /
Recombinant Human GDNF family receptor alpha-like(GFRAL),partial

Recombinant Human GDNF family receptor alpha-like(GFRAL),partial

ArtNr	CSB-EP751020HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSD PGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDD FYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHH GFKGMWSCLEVAEACVGDVVCNAQLASYLKACSAN GNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQ SDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQ NDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLS KQD
Protein Familie	GDNFR family
Citations	"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Targets	GFRAL
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	53.8 kDa
General Research Areas	Cell Biology
Expression Region	19-351aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Membrane, Single-pass membrane protein
Tissue Specificity	Expressed in the brainstem, restricted to cells in the area postrema and the immediately adjacent region of the nucleus tractus solitarius (at protein level) (PubMed:28846097, PubMed:28846098). Detected at low levels in testis and adipose tissue (PubMed:28846097).
Biologically active	Not Test
Protein length	Extracellular Domain

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP751020HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern