« Zurück
Startseite /
Recombinant Human Neuroepithelial cell-transforming gene 1 protein(NET1)

Recombinant Human Neuroepithelial cell-transforming gene 1 protein(NET1)

ArtNr	CSB-EP768775HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MVAHDETGGLLPIKRTIRVLDVNNQSFREQEEPSN KRVRPLARVTSLANLISPVRNGAVRRFGQTIQSFT LRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEM LDITMKESLTTREIRRQEAIYEMSRGEQDLIEDLK LARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLH EDLLTRIGEATKPDGTVEQIGHILVSWLPRLNAYR GYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFS RKL
Citations	The nuclear guanine nucleotide exchange factors Ect2 and Net1 regulate RhoB-mediated cell death after DNA damage.Srougi M.C., Burridge K.PLoS ONE 6:E17108-E17108(2011)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Proto-oncogene p65 Net1Rho guanine nucleotide exchange factor 8
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	77.9 kDa
General Research Areas	Signal Transduction
Relevance	Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.
Expression Region	1-542aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.
Subcellular Location	Cytoplasm, Nucleus
Tissue Specificity	Widely expressed.
Gene Names	NET1
Sequence Info	Full Length of Isoform 2
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP768775HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern