« Zurück
Startseite /
Recombinant Mouse Sushi repeat-containing protein SRPX2(Srpx2)

Recombinant Mouse Sushi repeat-containing protein SRPX2(Srpx2)

ArtNr	CSB-EP819154MO-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Konjugat/Tag	Myc, SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPR WCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCD RGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPF ITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRI CMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPE KLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHF PEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPIL KPP
Citations	Cloning and characterization of the sushi-repeat containing protein (SRP) as a novel interaction partner of Rh type C glycoprotein (RhCG). Huang C.-H., Chen H., Peng J., Chen Y. Submitted (JUN-2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Targets	Srpx2
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	70.5 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Neuroscience
Relevance	Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords). Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. Required for ultrasonic vocalizations.
Biologically Active	Not Test
Expression Region	26-468aa
Protein Length	Full Length of Mature Protein
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords). Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. Required for ultrasonic vocalizations.
Subcellular Location	Secreted, Cytoplasm, Cell surface, Cell junction, synapse
Tissue Specificity	Expressed in angiogenic endothelial cells (at protein level).

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP819154MO-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern