« Zurück
Startseite /
Recombinant Human Lymphokine-activated killer T-cell-originated protein kinase(PBK)

Recombinant Human Lymphokine-activated killer T-cell-originated protein kinase(PBK)

ArtNr	CSB-EP822241HU-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Targets for Rodent Neurosciences Neural Development Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer Adhesion Molecule Markers
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFM QKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPIC NDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTE ANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPA AIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVI KGDFETIKICDVGVSLPLDENMTVTDPEACYIGTE PWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSI PHI
Protein Familie	Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase subfamily
Citations	"PDZ-binding kinase participates in spermatogenesis." Zhao S., Dai J., Zhao W., Xia F., Zhou Z., Wang W., Gu S., Ying K., Xie Y., Mao Y. Int. J. Biochem. Cell Biol. 33:631-636(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cancer/testis antigen 84
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	63.1 kDa
General Research Areas	Cell Biology
Relevance	Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.
Expression Region	1-322aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.
Tissue Specificity	Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.
Gene Names	PBK
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP822241HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 23.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern