« Zurück
Startseite /
Recombinant Human Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe(LFNG)

Recombinant Human Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe(LFNG)

ArtNr	CSB-EP839868HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Adhesion Molecule Markers
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVV ITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHV DDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPI QAMERVSENKVRPVHFWFATGGAGFCISRGLALKM SPWASGGHFMNTAERIRLPDDCTIGYIVEALLGVP LIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFEN KRNAVHVKGPFSVEADPSRFRSIHCHLYPDTPWCP RTA
Protein Familie	Glycosyltransferase 31 family
Citations	"Clock regulatory elements control cyclic expression of Lunatic fringe during somitogenesis." Cole S.E., Levorse J.M., Tilghman S.M., Vogt T.F. Dev. Cell 3:75-84(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	55.2 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Neuroscience
Relevance	Glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. Decreases the binding of JAGGED1 to NOTCH2 but not that of DELTA1. Essential mediator of somite segmentation and patterning
Expression Region	1-250aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules. Modulates NOTCH1 activity by modifying O-fucose residues at specific EGF-like domains resulting in inhibition of NOTCH1 activation by JAG1 and enhancement of NOTCH1 activation by DLL1 via an increase in its binding to DLL1 (By similarity). Decreases the binding of JAG1 to NOTCH2 but not that of DLL1
Subcellular Location	Golgi apparatus membrane, Single-pass type II membrane protein
Involvement in disease	Spondylocostal dysostosis 3, autosomal recessive (SCDO3)
Pathway	Notchsignalingpathway
Gene Names	LFNG
Sequence Info	Full Length of Isoform 2
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP839868HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 06.11.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern