« Zurück
Startseite /
Recombinant Human Calcineurin subunit B type 2(PPP3R2)

Recombinant Human Calcineurin subunit B type 2(PPP3R2)

ArtNr	CSB-EP856978HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	GNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSG SLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVD FKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGY ISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILD KDGDGKISFEEFSAVVRDLEIHKKLVLIV
Protein Familie	Calcineurin regulatory subunit family
Citations	"Characterization of a human regulatory subunit of protein phosphatase 3 gene (PPP3RL) expressed specifically in testis." Liu L., Zhang J., Yuan J., Dang Y., Yang C., Chen X., Xu J., Yu L. Mol. Biol. Rep. 32:41-45(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Calcineurin B-like protein
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	46.4 kDa
General Research Areas	Signal Transduction
Relevance	Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity
Expression Region	1-170aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity (By similarity).
Tissue Specificity	Testis-specific.
Paythway	Calciumsignalingpathway
Gene Names	PPP3R2
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP856978HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern