Vergleich

Recombinant Human Interleukin-36 receptor antagonist protein(IL36RN)

ArtNr CSB-EP866201HU-10
Hersteller Cusabio
Menge 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGK VIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDM GLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG GWNAPITDFYFQQCD
Protein Familie IL-1 family
Citations Four new members expand the IL-1 superfamily.Smith D.E., Renshaw B.R., Ketchem R.R., Kubin M., Garka K.E., Sims J.E.J. Biol. Chem. 275:1169-1175(2000)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias FIL1 deltaIL-1-related protein 3 ,IL-1RP3Interleukin-1 HY1 ,IL-1HY1Interleukin-1 delta ,IL-1 deltaInterleukin-1 family member 5 ,IL-1F5Interleukin-1 receptor antagonist homolog 1 ,IL-1ra homolog 1Interleukin-1-like protein 1 ,IL-1L1
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
33 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Immunology
Relevance
Inhibits the activity of interleukin-36 (IL36A, IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling syst that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 syst with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Expression Region
1-155aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Inhibits the activity of interleukin-36 (IL36A, IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.
Subcellular Location
Secreted
Tissue Specificity
Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.
Involvement in disease
Psoriasis 14, pustular (PSORS14)
Gene Names
IL36RN
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen