Vergleich

Recombinant Human Nuclear distribution protein nudE-like 1(NDEL1)

ArtNr CSB-EP872414HU-200
Hersteller Cusabio
Menge 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARD ELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTR AIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE QRLNQAIERNAFLESELDEKESLLVSVQRLKDEAR DLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLT PSA
Protein Familie NudE family
Citations "NUDEL is a novel cdk5 substrate that associates with LIS1 and cytoplasmic dynein."
Niethammer M., Smith D.S., Ayala R., Peng J., Ko J., Lee M.-S., Morabito M., Tsai L.-H.
Neuron 28:697-711(2000)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Mitosin-associated protein 1
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
65.4 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Neuroscience
Relevance
Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus ends. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the centripetal motion of secretory vesicles and the coupling of the nucleus and centrosome. Also required during brain development for the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Plays a role, together with DISC1, in the regulation of neurite outgrowth. Required for mitosis in some cell types but appears to be dispensible for mitosis in cortical neuronal progenitors, which instead requires NDE1. Facilitates the polymerization of neurofilaments from the individual subunits NEFH and NEFL.
Expression Region
1-345aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus ends. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the centripetal motion of secretory vesicles and the coupling of the nucleus and centrosome. Also required during brain development for the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Plays a role, together with DISC1, in the regulation of neurite outgrowth. Required for mitosis in some cell types but appears to be dispensible for mitosis in cortical neuronal progenitors, which instead requires NDE1. Facilitates the polymerization of neurofilaments from the individual subunits NEFH and NEFL. Positively regulates lysosome peripheral distribution and ruffled border formation in osteoclasts (By similarity).
Subcellular Location
Cytoplasm, cytoskeleton, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Chromosome, centromere, kinetochore, Cytoplasm, cytoskeleton, spindle
Tissue Specificity
Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
Gene Names
NDEL1
Sequence Info
Full Length of BC026101
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen