« Zurück
Startseite /
Recombinant Human Intraflagellar transport protein 27 homolog(IFT27)

Recombinant Human Intraflagellar transport protein 27 homolog(IFT27)

ArtNr	CSB-EP874822HU-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKS YTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLE KARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLY REKVEVFRALA
Protein Familie	Small GTPase superfamily, Rab family
Citations	Reevaluating human gene annotation a second-generation analysis of chromosome 22.Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.Genome Res. 13:27-36(2003)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Putative GTP-binding protein RAY-likeRab-like protein 4
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	36.5 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Signal Transduction
Relevance	Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6 . Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6 . Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25 .
Expression Region	1-186aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6
Subcellular Location	Cell projection, cilium
Involvement in disease	Bardet-Biedl syndrome 19 (BBS19)
Gene Names	IFT27
Sequence Info	Full Length
Organism	Homo sapiens (Human)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP874822HU-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern