Vergleich

Recombinant Human Epidermal growth factor receptor(EGFR),partial (Active)

ArtNr CSB-MP007479HU-100
Hersteller Cusabio
Menge 100 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Mammalian cells
Konjugat/Tag Myc, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCE VVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALN TVERIPLENLQIIRGNMYYENSYALAVLSNYDANK TGLKELPMRNLQEILHGAVRFSNNPALCNVESIQW RDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSC WGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHN QCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLML YNP
Protein Familie Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Citations Expression of a truncated epidermal growth factor receptor-like protein (TEGFR) in ovarian cancer.
Ilekis J.V., Gariti J., Niederberger C., Scoccia B.
Gynecol. Oncol. 65:36-41(1997)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Proto-oncogene c-ErbB-1 (Receptor tyrosine-protein kinase erbB-1 ) (ERBB) (ERBB1) (HER1)
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
73.6 kDa
Buffer
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
General Research Areas
Cancer
Relevance
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, AREG, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules. May also activate the NF-kappa-B signaling cascade. Also directly phosphorylates other proteins like RGS16, activating its GTPase activity and probably coupling the EGF receptor signaling to the G protein-coupled receptor signaling. Also phosphorylates MUC1 and increases its interaction with SRC and CTNNB1/beta-catenin. Plays a role in enhancing learning and memory performance.Isoform 2 may act as an antagonist of EGF action. Acts as a receptor for hepatitis C virus in hepatocytes and facilitates its cell entry. Mediates HCV entry by promoting the formation of the CD81-CLDN1 receptor complexes that are essential for HCV entry and by enhancing membrane fusion of cells expressing HCV envelope glycoproteins.
Expression Region
25-645aa
Protein Length
Partial
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, amphiregulin, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules. May also activate the NF-kappa-B signaling cascade. Also directly phosphorylates other proteins like RGS16, activating its GTPase activity and probably coupling the EGF receptor signaling to the G protein-coupled receptor signaling. Also phosphorylates MUC1 and increases its interaction with SRC and CTNNB1/beta-catenin. Plays a role in enhancing learning and memory performance (By similarity).
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, Endosome, Endosome membrane, Nucleus
Tissue Specificity
Ubiquitously expressed. Isoform 2 is also expressed in ovarian cancers.
Involvement in disease
Lung cancer (LNCR); Inflammatory skin and bowel disease, neonatal, 2 (NISBD2)
Pathway
Calciumsignalingpathway
Biological activity
Active
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen