« Zurück
Startseite /
Recombinant Human Melanoma-associated antigen 1 (MAGEA1)

Recombinant Human Melanoma-associated antigen 1 (MAGEA1)

ArtNr	CSB-MP013323HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Kategorie	Oncology Neuroscience Aging & Neurological Disorders Neural Epigenetics Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Testicular & Prostate Cancer
Typ	Proteins Recombinant
Specific against	other
Host	Mammalian cells
Konjugat/Tag	FLAG, Myc
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSS SPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINF TRQRQPSEGSSSREEEGPSTSCILESLFRAVITKK VADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCF PEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCL GLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAP EEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQ EKY
Citations	"Cloning of human full-length CDSs in BD Creator(TM) system donor vector."Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Antigen MZ2-E,Cancer/testis antigen 1.1,CT1.1,MAGE-1 antigen
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal Flag-Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	38.8 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Cancer
Relevance	May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
Expression Region	1-309aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in transcriptional regulation through interaction with SNW1 and recruiting histone deactelyase HDAC1. May inhibit notch intracellular domain (NICD) transactivation. May play a role in embryonal development and tumor transformation or aspects of tumor progression. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
Subcellular Location	Cytoplasm, Nucleus
Tissue Specificity	Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. Never expressed in kidney tumors, leukemias and lymphomas.
Gene Names	MAGEA1
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP013323HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern