« Zurück
Startseite /
Recombinant Mouse Myoglobin(Mb)

Recombinant Mouse Myoglobin(Mb)

ArtNr	CSB-MP013529MO-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKT HPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLT ALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLE FISEIIIEVLKKRHSGDFGADAQGAMSKALELFRN DIAAKYKELGFQG
Protein Familie	Globin family
Citations	"The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes." Blanchetot A., Price M., Jeffreys A.J. Eur. J. Biochem. 159:469-474(1986)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	21.9 kDa
General Research Areas	Cancer
Relevance	Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Expression Region	2-154aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Biologically active	Not Test
Protein length	Full Length of Mature Protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP013529MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern