Vergleich

Recombinant Human Polypyrimidine tract-binding protein 1(PTBP1)

ArtNr CSB-MP018948HU-10
Hersteller Cusabio
Menge 10 ug
Quantity options 10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host Mammalian cells
Konjugat/Tag HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNS ASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDV TEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEE AANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDS SPNQARAQAALQAVNSVQSGNLALAASAAAVDAGM AMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTV LKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQN IYN
Citations "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 57 kDa RNA-binding protein PPTB-1 (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) (PTB) (PTB)
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
63.1 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10. In case of infection by picornaviruses, binds to the viral internal ribosome entry site and stimulates the IRES-mediated translation.
Expression Region
1-557aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10
Subcellular Location
Nucleus
Gene Names
PTBP1
Sequence Info
Full Length of Isoform
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen